PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI07G20980.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 544aa    MW: 60108.2 Da    PI: 6.4282
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI07G20980.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS437.11.3e-1331745431373
             GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                      l+elL++cA+av++++  +++ ++ +l++++s +g+p++Rl ay++e+L arla+s+ ++ykal+++e +   ss+ l+++++++e++P++kf+
  ORUFI07G20980.1 174 LKELLIACARAVEEKNSFAIDMMIPELRKIVSVSGEPLERLGAYMVEGLVARLASSGISIYKALKCKEPK---SSDLLSYMHFLYEACPYFKFG 264
                      5799*****************************************************************9...9******************** PP

             GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrl 186
                      ++ aN aI eav+ge+r+HiiDf isqG+QW++LlqaLa+Rp+gpp++RiTg++++ s   +   le +g+rL+++A+ ++vpfef++l a + 
  ORUFI07G20980.1 265 YMSANGAIAEAVKGEDRIHIIDFHISQGAQWISLLQALAARPGGPPTVRITGIDDSVSAyaRGGGLELVGRRLSHIASLCKVPFEFHPL-AISG 357
                      *******************************************************888899999************************6.7789 PP

             GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklprese 280
                      +++e  +L v pgEalaVn+ l+lh+++desvs++++rd++L++vkslsPkv+++ve e+++n+++F +rf+e+l+yy+a+f+s++ +lpr+++
  ORUFI07G20980.1 358 SKVEAAHLGVIPGEALAVNFTLELHHIPDESVSTANHRDRLLRMVKSLSPKVLTLVEMESNTNTAPFPQRFAETLDYYTAIFESIDLTLPRDDR 451
                      ********************************************************************************************** PP

             GRAS 281 erikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                      eri++E+++l+reivn++aceg+er er e ++kW++rl++aGF+p pls+ +++++++ll+ ++ d y++ e++g+l+lgWk+rpLv+ SaW
  ORUFI07G20980.1 452 ERINMEQHCLAREIVNLIACEGEERAERYEPFGKWKARLTMAGFRPSPLSSLVNATIRTLLQSYS-DNYKLAERDGALYLGWKSRPLVVSSAW 543
                      *****************************************************************.55************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098569.271148525IPR005202Transcription factor GRAS
PfamPF035144.3E-131174543IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005829Cellular Componentcytosol
Sequence ? help Back to Top
Protein Sequence    Length: 544 aa     Download sequence    Send to blast
MADTPTSRMI HPFSNIPSQN LKQFQYSDNP QHPCHPYRAP SDTHVVPHHY GLKSHSPDAG  60
YESQATPNKY TLDSSEGAGC MRHDSPSSQS FTTRSGSPLS QEDSHSDSTD GSPVGASCVT  120
EDPNDLKQKL KDLEAVMLGP DSEIVNSLEN SVANQLSLEP EKWVRMMGIP RGNLKELLIA  180
CARAVEEKNS FAIDMMIPEL RKIVSVSGEP LERLGAYMVE GLVARLASSG ISIYKALKCK  240
EPKSSDLLSY MHFLYEACPY FKFGYMSANG AIAEAVKGED RIHIIDFHIS QGAQWISLLQ  300
ALAARPGGPP TVRITGIDDS VSAYARGGGL ELVGRRLSHI ASLCKVPFEF HPLAISGSKV  360
EAAHLGVIPG EALAVNFTLE LHHIPDESVS TANHRDRLLR MVKSLSPKVL TLVEMESNTN  420
TAPFPQRFAE TLDYYTAIFE SIDLTLPRDD RERINMEQHC LAREIVNLIA CEGEERAERY  480
EPFGKWKARL TMAGFRPSPL SSLVNATIRT LLQSYSDNYK LAERDGALYL GWKSRPLVVS  540
SAWH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-661785448375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0734700.0AK073470.1 Oryza sativa Japonica Group cDNA clone:J033044I02, full insert sequence.
GenBankAK0988900.0AK098890.1 Oryza sativa Japonica Group cDNA clone:J013001M01, full insert sequence.
GenBankAP0037470.0AP003747.5 Oryza sativa Japonica Group genomic DNA, chromosome 7, BAC clone:OJ1127_E01.
GenBankAP0149630.0AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBankCP0126150.0CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646745.10.0PREDICTED: chitin-inducible gibberellin-responsive protein 2
SwissprotQ8GVE10.0CIGR2_ORYSJ; Chitin-inducible gibberellin-responsive protein 2
TrEMBLA2YN280.0A2YN28_ORYSI; Putative uncharacterized protein
TrEMBLA0A0E0QAE80.0A0A0E0QAE8_ORYRU; Uncharacterized protein
TrEMBLI1QEP30.0I1QEP3_ORYGL; Uncharacterized protein
STRINGBGIOSGA026022-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os07g39470.10.0(Oryza sativa Japonica Group)
STRINGORGLA07G0258500.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP151337117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein